General Information

  • ID:  hor002650
  • Uniprot ID:  Q94233
  • Protein name:  NLP-20
  • Gene name:  nlp-20
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  SGPQAHEGAGMRFAFA
  • Length:  16(67-82)
  • Propeptide:  MQVTLLALLLLIVPFFAFAASQYSDDDSELMSNNERFARDLELRKKFAFAFAKRSAGDADVVIEARSGPQAHEGAGMRFAFAKRRAPKEFARFARASFA
  • Signal peptide:  MQVTLLALLLLIVPFFAFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q94233-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002650_AF2.pdbhor002650_ESM.pdb

Physical Information

Mass: 190154 Formula: C71H104N22O21S
Absent amino acids: CDIKLNTVWY Common amino acids: A
pI: 7.55 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 6
Hydrophobicity: -22.5 Boman Index: -1696
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 25
Instability Index: 608.75 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans